PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G06180.1
Common NameATMYB13, ATMYBLFGN, F9P14.4, MYB13
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 246aa    MW: 27951.2 Da    PI: 6.1755
Description myb domain protein 13
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G06180.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l++++ ++G ++W++ ++  g+ R++k+c++rw +yl
      AT1G06180.1 14 KGPWSAEEDRILINYISLHGHPNWRALPKLAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding50.54.9e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++ ++ ++++lG++ W++Ia++++ gRt++++k+ w+++l
      AT1G06180.1  67 RGNFTPHEEDTIISLHQLLGNR-WSAIAAKLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.0E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.639961IPR017930Myb domain
SuperFamilySSF466898.63E-3011108IPR009057Homeodomain-like
SMARTSM007177.7E-141363IPR001005SANT/Myb domain
PfamPF002494.7E-151461IPR001005SANT/Myb domain
CDDcd001672.60E-101661No hitNo description
PROSITE profilePS5129423.562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2665116IPR009057Homeodomain-like
SMARTSM007171.4E-1366114IPR001005SANT/Myb domain
PfamPF002492.2E-1467112IPR001005SANT/Myb domain
CDDcd001674.85E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MGRRPCCEKI GLKKGPWSAE EDRILINYIS LHGHPNWRAL PKLAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TPHEEDTIIS LHQLLGNRWS AIAAKLPGRT DNEIKNVWHT HLKKRLHHSQ  120
DQNNKEDFVS TTAAEMPTSP QQQSSSSADI SAITTLGNNN DISNSNKDSA TSSEDVLAII  180
DESFWSEVVL MDCDISGNEK NEKKIENWEG SLDRNDKGYN HDMEFWFDHL TSSSCIIGEM  240
SDISEF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-25121165108B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO183906210.0
Genevisible260784_at0.0
Expression AtlasAT1G06180-
AtGenExpressAT1G06180-
ATTED-IIAT1G06180-
Functional Description ? help Back to Top
Source Description
TAIRmember of MYB3R- and R2R3- type MYB- encoding genes
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00127DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G06180.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G21970 (R), AT3G26790 (R)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, ethylene, gibberellin, jasmonic acid, salicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G06180
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195500.0AY519550.1 Arabidopsis thaliana MYB transcription factor (At1g06180) mRNA, complete cds.
GenBankBT0251730.0BT025173.1 Arabidopsis thaliana At1g06180 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_172108.10.0myb domain protein 13
TrEMBLQ9LNC90.0Q9LNC9_ARATH; At1g06180
STRINGAT1G06180.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Vicient CM,Bies-Etheve N,Delseny M
    Changes in gene expression in the leafy cotyledon1 (lec1) and fusca3 (fus3) mutants of Arabidopsis thaliana L.
    J. Exp. Bot., 2000. 51(347): p. 995-1003
    [PMID:10948227]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  4. Steffens NO,Galuschka C,Schindler M,B
    AthaMap: an online resource for in silico transcription factor binding sites in the Arabidopsis thaliana genome.
    Nucleic Acids Res., 2004. 32(Database issue): p. D368-72
    [PMID:14681436]
  5. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  6. Oravecz A, et al.
    CONSTITUTIVELY PHOTOMORPHOGENIC1 is required for the UV-B response in Arabidopsis.
    Plant Cell, 2006. 18(8): p. 1975-90
    [PMID:16829591]
  7. Nozawa A,Miwa K,Kobayashi M,Fujiwara T
    Isolation of Arabidopsis thaliana cDNAs that confer yeast boric acid tolerance.
    Biosci. Biotechnol. Biochem., 2006. 70(7): p. 1724-30
    [PMID:16861809]
  8. Cao D,Cheng H,Wu W,Soo HM,Peng J
    Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 509-25
    [PMID:16920880]
  9. AbuQamar S, et al.
    Expression profiling and mutant analysis reveals complex regulatory networks involved in Arabidopsis response to Botrytis infection.
    Plant J., 2006. 48(1): p. 28-44
    [PMID:16925600]
  10. Xin Z,Mandaokar A,Chen J,Last RL,Browse J
    Arabidopsis ESK1 encodes a novel regulator of freezing tolerance.
    Plant J., 2007. 49(5): p. 786-99
    [PMID:17316173]
  11. Bedon F,Grima-Pettenati J,Mackay J
    Conifer R2R3-MYB transcription factors: sequence analyses and gene expression in wood-forming tissues of white spruce (Picea glauca).
    BMC Plant Biol., 2007. 7: p. 17
    [PMID:17397551]
  12. Kleine T,Kindgren P,Benedict C,Hendrickson L,Strand A
    Genome-wide gene expression analysis reveals a critical role for CRYPTOCHROME1 in the response of Arabidopsis to high irradiance.
    Plant Physiol., 2007. 144(3): p. 1391-406
    [PMID:17478635]
  13. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  14. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  15. Kirik V,K
    Ectopic expression of a novel MYB gene modifies the architecture of the Arabidopsis inflorescence.
    Plant J., 1998. 13(6): p. 729-42
    [PMID:9681014]
  16. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]